General Information

  • ID:  hor006451
  • Uniprot ID:  P91797
  • Protein name:  Molluscan insulin-related peptide 7 A chain
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila , Panpulmonata , Euthyneura , Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa , Spiralia , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  EVMAEPSLVCDCCYNECSVRKLATYC
  • Length:  26(155-180)
  • Propeptide:  MNASVESCLTFTFVLVALCVGLTIGQQVNTCTMFSRQHPRGLCGNRLARAHANLCFLLRNTYPDIFPRKRSVDNTFEKVYSIPLSVLAELDLSDDDWGAYVSKKDIPYRSETNGLSGANFESSAFDKQLELPAMKSTTSQLFRILKLRGSRLKREVMAEPSLVCDCCYNECSVRKLATYC
  • Signal peptide:  MNASVESCLTFTFVLVALCVGLTIG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  46008
  • Structure ID:  AF-P91797-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006451_AF2.pdbhor006451_ESM.pdb

Physical Information

Mass: 337652 Formula: C121H193N31O41S6
Absent amino acids: FGHIQW Common amino acids: C
pI: 4.15 Basic residues: 2
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: 22.31 Boman Index: -3158
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 71.15
Instability Index: 5021.92 Extinction Coefficient cystines: 3230
Absorbance 280nm: 129.2

Literature

  • PubMed ID:  8848162
  • Title:  Expression and characterization of molluscan insulin-related peptide VII from the mollusc Lymnaea stagnalis.